islandwidechimneysweepservices.co.uk

4 Days to go

Make now the first bid for these domain!

End of auction: Oct 13, 2025 at 8:00 PM

Bid on the domain islandwidechimneysweepservices.co.uk

The domain is currently in the status RGP (redemption grace period), a kind of quarantine or waiting period. The domain has been deleted by the previous domain owner and can soon be registered anew.

We offer the service to try to register this domain for you before the domain is re-registered by a third party.


Here are some facts about the domain islandwidechimneysweepservices.co.uk:

  • This .co.uk domain consists of 30 charakters.
  • First letter is i
  • Keywords: Islandwidechimneysweepservices
  • This domain can probably be registered by us on Oct 14, 2025 after you gave your bid.
Register now and bid for the domain!

Our top auctions

1 Day
€3,343
< 14 h
€2,010
3 Days
€1,675
< 14 h
€1,660
< 14 h
€1,328
< 14 h
€1,135
2 Days
€1,030
< 14 h
€1,010
1 Day
€920
7 Days
€820
7 Days
€810
4 Days
€611
2 Days
€610
1 Day
€610
13 Days
€609
3 Days
€600
< 14 h
€581
9 Days
€580
2 Days
€530
3 Days
€530
2 Days
€435
3 Days
€410
1 Day
€403
< 14 h
€360
28 Days
€360
22 Days
€351